PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj6g3v1333010.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HB-PHD
Protein Properties Length: 721aa    MW: 81180.3 Da    PI: 8.4941
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj6g3v1333010.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.6e-10503547953
                      HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
         Homeobox   9 keqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                      ++ le L ++F++n  p ++ +e L+k+lg++ ++V+ WF+N R+
  Lj6g3v1333010.2 503 HDALEKLRQVFAENELPPRSVKEGLSKELGIDAAKVSKWFKNARY 547
                      6889***************************************96 PP

2PHD40.85.2e-14239294151
                      SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
              PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                      +C+ C+   +  +++++lCd +C+++fH+ Cl+++l++e++p g   w+C+ C++k
  Lj6g3v1333010.2 239 FCANCKLreAFPDNDIILCDgTCNRAFHQRCLNPPLDTENIPPGdqGWFCNFCECK 294
                      699999954555********56********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579033.1E-14230296IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.5E-12236295IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.54237294IPR019787Zinc finger, PHD-finger
PfamPF006285.3E-11239294IPR019787Zinc finger, PHD-finger
CDDcd155041.03E-28239291No hitNo description
SMARTSM002491.9E-9239292IPR001965Zinc finger, PHD-type
PROSITE patternPS013590240291IPR019786Zinc finger, PHD-type, conserved site
Gene3DG3DSA:1.10.10.605.4E-10483546IPR009057Homeodomain-like
SuperFamilySSF466894.15E-9490547IPR009057Homeodomain-like
PROSITE profilePS5007110.884492552IPR001356Homeobox domain
SMARTSM003891.6E-4494556IPR001356Homeobox domain
CDDcd000861.95E-6500547No hitNo description
PfamPF000461.4E-7503547IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MFCLQLQGTE KLNGTGSTKS SNSEEHAESK VDSLRYRTNI TKCRGKKQKL KSKSHKLSGC  60
LSASGRTVTN SSIKRQVKDS SNKKIIRQSL HKTDGKSSRM LSSTMIQGGK SSLGSRKEGK  120
DVDGEVMVQK VKRKRKKKRR QDDVDLDDAS RLLRRTRYLL IKMKLEQNLI DAYSGEGWKG  180
QSREKIRPEK ELQRAKKQIL NCKLSIRDAI RQLDSLSSLG SIEDSVIDPD GSVYHEHIFC  240
ANCKLREAFP DNDIILCDGT CNRAFHQRCL NPPLDTENIP PGDQGWFCNF CECKIEILEA  300
TNAHLGTQIS LDSTWQDVFK EEAAIPDGDN ALLNPEEEWP SDDPEDDDYY PERKEDNHSI  360
KAEGTDDNAS NDLSSSSSLG SLNGECSPVD EGTGLEYYSV NCCIDSDDSG EIACGRRQRK  420
SVDYKKLYDE MFGKDAPPCE LVSEDEDWGT GKRKRREKES DAVNTLMTMH ESENKNPNNE  480
NSDGIREGSS GKPIRRSCFR IPHDALEKLR QVFAENELPP RSVKEGLSKE LGIDAAKVSK  540
WFKNARYFAL KARKYQAGGE QLQSFTSKTP KDSRSQNVDK DELLKSMASK ITVTQYQKNG  600
KNVTGREKIK SCSSPLKKRR LQIPPPLREN GNKGSMEVND DVSLKKLLKE KKTRVNFISE  660
GDSQAAELEF ERISKLKAKL DSMKQKLTEV QNLRASGSDK LCSNEPSVIY VPIAELREKV  720
E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139KRKRKKKRR
2132136RKRKK
3133139KRKKKRR
4133140KRKKKRRQ
5135139KKKRR
6452457RKRREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0045170.0AP004517.1 Lotus japonicus genomic DNA, chromosome 6, clone: LjT14B06, TM0045, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004487993.10.0PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487851e-150PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLK7MBU20.0K7MBU2_SOYBN; Uncharacterized protein
STRINGGLYMA15G17956.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF52753349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.22e-94pathogenesis related homeodomain protein A